(data stored in ACNUC7421 zone)

EMBL: FM180568.YAIL

FM180568.YAIL        Location/Qualifiers
FT   CDS             342382..342921
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="E2348C_0301"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07849"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJJ1"
FT                   /protein_id="CAS07849.1"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQTQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQN
FT                   EDDPYADFKVPDDLMW"
     MAKLTLQEQL LKAGLVTSKK AAKVERTAKK SRVQAREARA AVEENKKAQL ERDKQLSEQQ        60
     KQAALAKEYK AQVKQLIEMN RITIANGDIG FNFTDGNLIK KIFVDKLTQT QLINGRLAIA       120
     RLLVDNNSEG EYAIIPASVA DKIAQRDASS IVLHSALSAE EQNEDDPYAD FKVPDDLMW        179
//

If you have problems or comments...

PBIL Back to PBIL home page