(data stored in ACNUC7421 zone)

EMBL: FM180568.YAJC

FM180568.YAJC        Location/Qualifiers
FT   CDS             386455..386787
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="E2348C_0342"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07890"
FT                   /db_xref="GOA:B7UJN0"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJN0"
FT                   /protein_id="CAS07890.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
     MSFFISDAVA ATGAPAQGSP MSLILMLVVF GLIFYFMILR PQQKRTKEHK KLMDSIAKGD        60
     EVLTNGGLVG RVTKVAENGY IAIALNDTTE VVIKRDFVAA VLPKGTMKAL                  110
//

If you have problems or comments...

PBIL Back to PBIL home page