(data stored in ACNUC7421 zone)

EMBL: FM180568.YAJD

FM180568.YAJD        Location/Qualifiers
FT   CDS             389773..390120
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="E2348C_0345"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07893"
FT                   /db_xref="GOA:B7UJN3"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJN3"
FT                   /protein_id="CAS07893.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
     MAIIPKNYAR LESGYREKAL KIYPWVCGRC SREFVYSNLR ELTVHHIDHD HTNNPEDGSN        60
     WELLCLYCHD HEHSKYTEAD QYGTTVIAGE DAQKDVGEAK YNPFADLKAM MNKKK            115
//

If you have problems or comments...

PBIL Back to PBIL home page