(data stored in ACNUC7421 zone)

EMBL: FM180568.YAJL

FM180568.YAJL        Location/Qualifiers
FT   CDS             complement(401955..402545)
FT                   /transl_table=11
FT                   /gene="yajL"
FT                   /locus_tag="E2348C_0359"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07907"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJP7"
FT                   /protein_id="CAS07907.1"
FT                   /translation="MSASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAI
FT                   TCSRGVKMLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAA
FT                   ICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE"
     MSASALVCLA PGSEETEAVT TIDLLVRGGI KVTTASVASD GNLAITCSRG VKMLADAPLV        60
     EVADGEYDVI VLPGGIKGAE CFRDSTLLVE TVKQFHRSGR IVAAICAAPA TVLVPHDIFP       120
     IGNMTGFPTL KDKIPAEQWQ DKRVVWDARV KLLTSQGPGT AIDFGLKIID LLVGREKAHE       180
     VASQLVMAAG IYNYYE                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page