(data stored in ACNUC7421 zone)

EMBL: FM180568.YAJQ

FM180568.YAJQ        Location/Qualifiers
FT   CDS             403587..404078
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="E2348C_0361"
FT                   /product="predicted nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07909"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJP9"
FT                   /protein_id="CAS07909.1"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAVVRGGDLGQPFQFKNFRD
FT                   "
     MPSFDIVSEV DLQEARNAVD NASREVESRF DFRNVEASFE LNDASKTIKV LSESDFQVNQ        60
     LLDILRAKLL KRGIEGSSLD VPENIVHSGK TWFVEAKLKQ GIESATQKKI VKMIKDSKLK       120
     VQAQIQGDEI RVTGKSRDDL QAVMAVVRGG DLGQPFQFKN FRD                         163
//

If you have problems or comments...

PBIL Back to PBIL home page