(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAB

FM180568.YBAB        Location/Qualifiers
FT   CDS             454553..454882
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="E2348C_0406"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07954"
FT                   /db_xref="GOA:B7UKF1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UKF1"
FT                   /protein_id="CAS07954.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
     MFGKGGLGNL MKQAQQMQEK MQKMQEEIAQ LEVTGESGAG LVKVTINGAH NCRRVEIDPS        60
     LLEDDKEMLE DLVAAAFNDA ARRIEETQKE KMASVSSGMQ LPPGFKMPF                   109
//

If you have problems or comments...

PBIL Back to PBIL home page