(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAJ

FM180568.YBAJ        Location/Qualifiers
FT   CDS             complement(440812..441186)
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="E2348C_0396"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07944"
FT                   /db_xref="InterPro:IPR019693"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKE1"
FT                   /protein_id="CAS07944.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAIN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYLDDTFMLFSSYGINMQDLQKWRKSG
FT                   NRLFRCFVNATKENPASLSC"
     MDEYSPKRHD IAQLKFLCET LYHDCLANLE ESNHGWVNDP TSAINLQLNE LIEHIATFAL        60
     NYKIKYNEDN KLIEQIDEYL DDTFMLFSSY GINMQDLQKW RKSGNRLFRC FVNATKENPA       120
     SLSC                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page