(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAK

FM180568.YBAK        Location/Qualifiers
FT   CDS             complement(466974..467453)
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="E2348C_0416"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07964"
FT                   /db_xref="GOA:B7UKG1"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKG1"
FT                   /protein_id="CAS07964.1"
FT                   /translation="MTPAVKLLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVY
FT                   KTLLVAVNGDMKHLAVAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGIS
FT                   PLGQKKRLPTIIDAPAQEFATIYVSGGKRGLDIELAAGDLAKILDAKFADIARRD"
     MTPAVKLLEK NKISFQIHTY EHDPAETNFG DEVVKKLGLN PDQVYKTLLV AVNGDMKHLA        60
     VAVTPVAGQL DLKKVAKALG AKKVEMADPM VAQRSTGYLV GGISPLGQKK RLPTIIDAPA       120
     QEFATIYVSG GKRGLDIELA AGDLAKILDA KFADIARRD                              159
//

If you have problems or comments...

PBIL Back to PBIL home page