(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAN

FM180568.YBAN        Location/Qualifiers
FT   CDS             451359..451736
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="E2348C_0403"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07951"
FT                   /db_xref="GOA:B7UKE8"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKE8"
FT                   /protein_id="CAS07951.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGAKPRAILLILITFTISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
     MQRIILIIIG WLAVVLGTLG VVLPVLPTTP FILLAAWCFA RSSPRFHAWL LYRSWFGSYL        60
     RFWQKHHAMP RGAKPRAILL ILITFTISLW FVQMPWVRIM LLVILACLLF YMWRIPVIDE       120
     KQEKH                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page