(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAP

FM180568.YBAP        Location/Qualifiers
FT   CDS             complement(467656..468450)
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="E2348C_0417"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07965"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKG2"
FT                   /protein_id="CAS07965.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDISLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEEQLQNLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEK
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMGWWLNAPPQNNEITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRDMPPGRYVVAVGALHLYGEGNLPQMLR"
     MDLLYRVKTL WAALRGNHYT WPAIDISLPG NRHFHLIGSI HMGSHDMAPL PTRLLKKLKN        60
     ADALIVEADV STSDTPFANL PACEALEERI SEEQLQNLQH ISQEMGISPS LFSTQPLWQI       120
     AMVLQATQAQ KLGLRAEYGI DYQLLQAAKQ QHKPVIELEG AEKQIAMLLQ LPDKGLALLD       180
     DTLTHWHTNA RLLQQMMGWW LNAPPQNNEI TLPNTFSQSL YDVLMHQRNL AWRDKLRDMP       240
     PGRYVVAVGA LHLYGEGNLP QMLR                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page