(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAV

FM180568.YBAV        Location/Qualifiers
FT   CDS             422842..423213
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="E2348C_0377"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07925"
FT                   /db_xref="GOA:B7UJR5"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJR5"
FT                   /protein_id="CAS07925.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAAPAAKPTTVETKAEAPAAQ
FT                   SKAAVPAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
     MKHGIKALLI TLSLACAGMS HSALAAAPAA KPTTVETKAE APAAQSKAAV PAKASDEEGT        60
     RVSINNASAE ELARAMNGVG LKKAQAIVSY REEYGPFKTV EDLKQVPGMG NSLVERNLAV       120
     LTL                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page