(data stored in ACNUC7421 zone)

EMBL: FM180568.YBAW

FM180568.YBAW        Location/Qualifiers
FT   CDS             423319..423717
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="E2348C_0378"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07926"
FT                   /db_xref="GOA:B7UJR6"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJR6"
FT                   /protein_id="CAS07926.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWHGLENSDSFHWMT
FT                   AHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQIITLEPEGQVVADALI
FT                   TFVCIDLKTQKALALEGELREKLEQMVK"
     MQTQIKVRGY HLDVYQHVNN ARYLEFLEEA RWHGLENSDS FHWMTAHNIA FVVVNININY        60
     RRPAVLSDLL TITSQLQQLN GKSGILSQII TLEPEGQVVA DALITFVCID LKTQKALALE       120
     GELREKLEQM VK                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page