(data stored in ACNUC7421 zone)

EMBL: FM180568.YBBA

FM180568.YBBA        Location/Qualifiers
FT   CDS             483184..483870
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="E2348C_0434"
FT                   /product="predicted transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07982"
FT                   /db_xref="GOA:B7UKH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH8"
FT                   /protein_id="CAS07982.1"
FT                   /translation="MPAENIVEVHHLKKSVGQGEHELSILTGVELVVKRGETIALVGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGQPLHNMDEEARAKLRAKHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGESSAESRNGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLIMVTHDLQLAARCDRCLRLVNG
FT                   QLQEEV"
     MPAENIVEVH HLKKSVGQGE HELSILTGVE LVVKRGETIA LVGESGSGKS TLLAILAGLD        60
     DGSSGEVSLV GQPLHNMDEE ARAKLRAKHV GFVFQSFMLI PTLNALENVE LPALLRGESS       120
     AESRNGAKAL LEQLGLGKRL DHLPAQLSGG EQQRVALARA FNGRPDVLFA DEPTGNLDRQ       180
     TGDKIADLLF SLNREHGTTL IMVTHDLQLA ARCDRCLRLV NGQLQEEV                    228
//

If you have problems or comments...

PBIL Back to PBIL home page