(data stored in ACNUC7421 zone)

EMBL: FM180568.YBBJ

FM180568.YBBJ        Location/Qualifiers
FT   CDS             complement(477852..478307)
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="E2348C_0427"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07975"
FT                   /db_xref="GOA:B7UKH1"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH1"
FT                   /protein_id="CAS07975.1"
FT                   /translation="MELMVVHQHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVV
FT                   WLLPLGWEWQGVMFAVLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGQRFVLES
FT                   PLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLIIRAVIA"
     MELMVVHQHI FWLSLGGLLL AAEMLGGNGY LLWSGVAAVI TGLVVWLLPL GWEWQGVMFA        60
     VLTLLAAWLW WKWLSRRVRE QKHSDSHLNQ RGQQLIGQRF VLESPLVNGR GHMRVGDSSW       120
     PVSASEDLGA GTHVEVIAIE GITLIIRAVI A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page