(data stored in ACNUC7421 zone)

EMBL: FM180568.YBBL

FM180568.YBBL        Location/Qualifiers
FT   CDS             479370..480047
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="E2348C_0429"
FT                   /product="predicted transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07977"
FT                   /db_xref="GOA:B7UKH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH3"
FT                   /protein_id="CAS07977.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDTKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
     MQENSPLLQL QNVGYLAGDT KILNNINFSL RAGEFKLITG PSGCGKSTLL KIVASLISPT        60
     SGTLLFEGED VSTLKPEIYR QQVSYCAQTP TLFGDTVYDN LIFPWQIRNQ QPDPAIFLDF       120
     LERFALPDSI LTKNIAELSG GEKQRISLIR NLQFMPKVLL LDEITSALDE SNKHNVNEMI       180
     HRYVREQNIA VLWVTHDKDE INHADKVITL QPHAGEMQEA RYELA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page