(data stored in ACNUC7421 zone)

EMBL: FM180568.YBBM

FM180568.YBBM        Location/Qualifiers
FT   CDS             480034..480813
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="E2348C_0430"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07978"
FT                   /db_xref="GOA:B7UKH4"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH4"
FT                   /protein_id="CAS07978.1"
FT                   /translation="MNSHNITNESLALALMLVVVAILISHKEKLALEKDILWSVGRAII
FT                   QLIIVGYVLKYIFSVDDACLTLLMVLFICFNAAWNAQKRSKYIAKAFISSFIAITVGAG
FT                   ITLAVLILSGSIEFIPMQVIPIAGMIAGNAMVAVGVCYNNLGQRVISEQQQIQEKLSLG
FT                   ATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVTQLKKK"
     MNSHNITNES LALALMLVVV AILISHKEKL ALEKDILWSV GRAIIQLIIV GYVLKYIFSV        60
     DDACLTLLMV LFICFNAAWN AQKRSKYIAK AFISSFIAIT VGAGITLAVL ILSGSIEFIP       120
     MQVIPIAGMI AGNAMVAVGV CYNNLGQRVI SEQQQIQEKL SLGATPKQAS AILIRDSIRA       180
     ALIPTVDSAK TVGLVSLPGM MSGLIFAGID PVKAIKYQIM VTFMLLSTAS LSTIIACYLT       240
     YRKFYNSRHQ LVVTQLKKK                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page