(data stored in ACNUC7421 zone)

EMBL: FM180568.YBBP

FM180568.YBBP        Location/Qualifiers
FT   CDS             483867..486281
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="E2348C_0435"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07983"
FT                   /db_xref="GOA:B7UKH9"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH9"
FT                   /protein_id="CAS07983.1"
FT                   /translation="MIARWFWREWRSPSLLIVWLALSLAVACVLALGNISDRMEKGLSQ
FT                   QSREFMAGDRALRSSREVPQAWLEEAQKRGLKVGKQLTFATMTFAGDTPQLANVKAVDD
FT                   IYPMYGELQTNPPGLKPQAGSVLLAPRLMALLNLKTGDTIDVGDATLRIAGEVIQEPDS
FT                   GFNPFQMAPRLMMNLADVDKTGAVQPGSRVTWRYKFGGSENQLDGYEKWLLPQLKPEQR
FT                   WYGLEQDEGALGRSIERSQQFLLLSALLTLLLAVAAVAVAMNHYCRSRYDLVAILKTLG
FT                   AGRAQLRKLIVGQWLMVLALSAVTGGAIGLLFENVLMVLLKPVLPAALPPASLWPWLWA
FT                   LGTMTVISLLVGLRPYRLLLATQPLRVLRNDVVANVWPLKFYLPIVTVVVVLLLAGLMG
FT                   GSMLLWAVLAGAVVLALLCGVLGWMLLNVLRRMTLKSLPLRLAVSRLLRQPWSTLSQLS
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIATEQVTPLKAFLAEHQIVPE
FT                   SFYPVVRARLTAINDKPTEGNGDEALNRELNLTWQNTRPDHNPIVAGNWPPKADEVSME
FT                   EGLAKRLNVALGDTVTFMGDTQEFRAKVTSLRKVDWESLRPNFYFIFPEGALDGQPQSW
FT                   LTSFRWENGNGMLTQLNRQFPTISLLDIGAILKQVGQVLEQVSRALEVMVVLVTACGML
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGFVSGLVAAIGAETALAV
FT                   LQSKVFDFPWEPDWRLWIVLPCSGALLLSLCGGWLGARLLKGKALFRQFAG"
     MIARWFWREW RSPSLLIVWL ALSLAVACVL ALGNISDRME KGLSQQSREF MAGDRALRSS        60
     REVPQAWLEE AQKRGLKVGK QLTFATMTFA GDTPQLANVK AVDDIYPMYG ELQTNPPGLK       120
     PQAGSVLLAP RLMALLNLKT GDTIDVGDAT LRIAGEVIQE PDSGFNPFQM APRLMMNLAD       180
     VDKTGAVQPG SRVTWRYKFG GSENQLDGYE KWLLPQLKPE QRWYGLEQDE GALGRSIERS       240
     QQFLLLSALL TLLLAVAAVA VAMNHYCRSR YDLVAILKTL GAGRAQLRKL IVGQWLMVLA       300
     LSAVTGGAIG LLFENVLMVL LKPVLPAALP PASLWPWLWA LGTMTVISLL VGLRPYRLLL       360
     ATQPLRVLRN DVVANVWPLK FYLPIVTVVV VLLLAGLMGG SMLLWAVLAG AVVLALLCGV       420
     LGWMLLNVLR RMTLKSLPLR LAVSRLLRQP WSTLSQLSAF SLSFMLLALL LVLRGDLLDR       480
     WQQQLPPESP NYFLINIATE QVTPLKAFLA EHQIVPESFY PVVRARLTAI NDKPTEGNGD       540
     EALNRELNLT WQNTRPDHNP IVAGNWPPKA DEVSMEEGLA KRLNVALGDT VTFMGDTQEF       600
     RAKVTSLRKV DWESLRPNFY FIFPEGALDG QPQSWLTSFR WENGNGMLTQ LNRQFPTISL       660
     LDIGAILKQV GQVLEQVSRA LEVMVVLVTA CGMLLLLAQV QVGMRQRHQE LVVWRTLGAG       720
     KKLLRTTLWC EFAMLGFVSG LVAAIGAETA LAVLQSKVFD FPWEPDWRLW IVLPCSGALL       780
     LSLCGGWLGA RLLKGKALFR QFAG                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page