(data stored in ACNUC7421 zone)

EMBL: FM180568.YBCH

FM180568.YBCH        Location/Qualifiers
FT   CDS             complement(519549..520439)
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="E2348C_0467"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08015"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKK9"
FT                   /protein_id="CAS08015.1"
FT                   /translation="MRKFIFVLLTLLLVSPFSFAMKGIIWQPQNRDSQVTDTQWQGLMS
FT                   QLRLQGFDTLVLQWTRYGDAFTQPEQRALLFKRAAAAQQAGLKLIVGLNADPEFFMHQK
FT                   QSSAALESYLNRLLAADLQQARLWSAAPGVTPDGWYISAEIDDLNWRSEAARQPLLTWL
FT                   NNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEQVKTTGVNVWVQDGSGGDKLTAEQ
FT                   RERYLQASADCQSSAPASGIVYELFVARKGKTFTAKPKPDAEIASLLAKRSSCGKDTLY
FT                   FSLRYLPAAQSILEY"
     MRKFIFVLLT LLLVSPFSFA MKGIIWQPQN RDSQVTDTQW QGLMSQLRLQ GFDTLVLQWT        60
     RYGDAFTQPE QRALLFKRAA AAQQAGLKLI VGLNADPEFF MHQKQSSAAL ESYLNRLLAA       120
     DLQQARLWSA APGVTPDGWY ISAEIDDLNW RSEAARQPLL TWLNNAQRLI SDVSAKPVYI       180
     SSFFAGNMSP DGYRQLLEQV KTTGVNVWVQ DGSGGDKLTA EQRERYLQAS ADCQSSAPAS       240
     GIVYELFVAR KGKTFTAKPK PDAEIASLLA KRSSCGKDTL YFSLRYLPAA QSILEY           296
//

If you have problems or comments...

PBIL Back to PBIL home page