(data stored in ACNUC7421 zone)

EMBL: FM180568.YBCI

FM180568.YBCI        Location/Qualifiers
FT   CDS             complement(513934..514455)
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="E2348C_0460"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08008"
FT                   /db_xref="GOA:B7UKK4"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKK4"
FT                   /protein_id="CAS08008.1"
FT                   /translation="MPTVITHAAVLLCIGLGLGSKAIPPRLLFAGIILAMLPDADVLSF
FT                   KFGVAYGNVFGHRGFIHSLVFAFVVPLLCVLIGRRWFRTGLIRCWLFLTVSLLSHSLLD
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTLYGHQVIISELMWVWLPGML
FT                   LMGMLWWRRR"
     MPTVITHAAV LLCIGLGLGS KAIPPRLLFA GIILAMLPDA DVLSFKFGVA YGNVFGHRGF        60
     IHSLVFAFVV PLLCVLIGRR WFRTGLIRCW LFLTVSLLSH SLLDSVTTGG KGVGWLWPWS       120
     DERFFAPWQV IKVAPFALSR YTTLYGHQVI ISELMWVWLP GMLLMGMLWW RRR              173
//

If you have problems or comments...

PBIL Back to PBIL home page