(data stored in ACNUC7421 zone)

EMBL: FM180568.YBDB

FM180568.YBDB        Location/Qualifiers
FT   CDS             560181..560594
FT                   /transl_table=11
FT                   /gene="ybdB"
FT                   /locus_tag="E2348C_0499"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08047"
FT                   /db_xref="GOA:B7UKP0"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR026576"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKP0"
FT                   /protein_id="CAS08047.1"
FT                   /translation="MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTR
FT                   THQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQP
FT                   LHLGRQNQSWEIVVFDERGRRCCTCRLGTAVLG"
     MIWKRHLTLD ELNATSDNTM VAHLGIVYTR LGDDVLEAEM PVDTRTHQPF GLLHGGASAA        60
     LAETLGSMAG FMMTRDGQCV VGTELNATHH RPVSEGKVRG VCQPLHLGRQ NQSWEIVVFD       120
     ERGRRCCTCR LGTAVLG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page