(data stored in ACNUC7421 zone)

EMBL: FM180568.YBDD

FM180568.YBDD        Location/Qualifiers
FT   CDS             562993..563190
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /locus_tag="E2348C_0501"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08049"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKP2"
FT                   /protein_id="CAS08049.1"
FT                   /translation="MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
     MFDSLAKAGK YLGQAAKLMI GMPDYDNYVE HMRVNHPDQT PMTYEEFFRE RQDARYGGKG        60
     GARCC                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page