(data stored in ACNUC7421 zone)

EMBL: FM180568.YBDF

FM180568.YBDF        Location/Qualifiers
FT   CDS             complement(537919..538302)
FT                   /transl_table=11
FT                   /gene="ybdF"
FT                   /locus_tag="E2348C_0479"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08027"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKM1"
FT                   /protein_id="CAS08027.1"
FT                   /translation="MDKQSLHETAKRLALELPFVELCWPFGPEFDVFKIGGKIFMLSSE
FT                   LRGVPFINLKSDPQKSLLNQQIYPSIKPGYHMNKKHWISVYPGEEISEALLRDLINDSW
FT                   NLVVDGLAKRDQKRVRPDSTVNQ"
     MDKQSLHETA KRLALELPFV ELCWPFGPEF DVFKIGGKIF MLSSELRGVP FINLKSDPQK        60
     SLLNQQIYPS IKPGYHMNKK HWISVYPGEE ISEALLRDLI NDSWNLVVDG LAKRDQKRVR       120
     PDSTVNQ                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page