(data stored in ACNUC7421 zone)

EMBL: FM180568.YBEA

FM180568.YBEA        Location/Qualifiers
FT   CDS             complement(597035..597502)
FT                   /transl_table=11
FT                   /gene="ybeA"
FT                   /locus_tag="E2348C_0536"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08084"
FT                   /db_xref="GOA:B7UKS6"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UKS6"
FT                   /protein_id="CAS08084.1"
FT                   /translation="MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGG
FT                   PEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE"
     MKLQLVAVGT KMPDWVQTGF TEYLRRFPKD MPFELIEIPA GKRGKNADIK RILDKEGEQM        60
     LAAAGKNRIV TLDIPGKPWD TPQLAAELER WKLDGRDVSL LIGGPEGLSP ACKAAAEQSW       120
     SLSALTLPHP LVRVLVAESL YRAWSITTNH PYHRE                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page