(data stored in ACNUC7421 zone)

EMBL: FM180568.YBEL

FM180568.YBEL        Location/Qualifiers
FT   CDS             603805..604287
FT                   /transl_table=11
FT                   /gene="ybeL"
FT                   /locus_tag="E2348C_0543"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08091"
FT                   /db_xref="InterPro:IPR009912"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKT3"
FT                   /protein_id="CAS08091.1"
FT                   /translation="MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTR
FT                   TEVDELTRAVRRDLEEFAMSYEESLKEESDSVFMRVIKESLWQELADITDKTQLEWREV
FT                   FQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRPFEP"
     MNKVAQYYRE LVASLSERLR NGERDIDALV EQARERVIKT GELTRTEVDE LTRAVRRDLE        60
     EFAMSYEESL KEESDSVFMR VIKESLWQEL ADITDKTQLE WREVFQDLNH HGVYHSGEVV       120
     GLGNLVCEKC HFHLPIYTPE VLTLCPKCGH DQFQRRPFEP                             160
//

If you have problems or comments...

PBIL Back to PBIL home page