(data stored in ACNUC7421 zone)

EMBL: FM180568.YBEY

FM180568.YBEY        Location/Qualifiers
FT   CDS             complement(613600..614067)
FT                   /transl_table=11
FT                   /gene="ybeY"
FT                   /locus_tag="E2348C_0552"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08100"
FT                   /db_xref="GOA:B7UKU2"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UKU2"
FT                   /protein_id="CAS08100.1"
FT                   /translation="MSQVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRV
FT                   VDTAESHSLNLTYRGKDKPTNVLSFPFEVPPGMEMSLLGDLVICRQVVEKEAQEQGKPL
FT                   EAHWAHMVVHGSLHLLGYDHIEDDEAEEMEAIETEIMLALGYEDPYIAEKE"
     MSQVILDLQL ACEDNSGLPE ESQFQTWLNA VIPQFQEESE VTIRVVDTAE SHSLNLTYRG        60
     KDKPTNVLSF PFEVPPGMEM SLLGDLVICR QVVEKEAQEQ GKPLEAHWAH MVVHGSLHLL       120
     GYDHIEDDEA EEMEAIETEI MLALGYEDPY IAEKE                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page