(data stored in ACNUC7421 zone)

EMBL: FM180568.YBFA

FM180568.YBFA        Location/Qualifiers
FT   CDS             657870..658076
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="E2348C_0589"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08137"
FT                   /db_xref="GOA:B7UKX9"
FT                   /db_xref="InterPro:IPR019663"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKX9"
FT                   /protein_id="CAS08137.1"
FT                   /translation="MELYKEYPAWLIFLRRTCAVAAGVLALPFMLFWKDRARFYSYLHR
FT                   VWSKTSDKPVWMDQAEKATGDFY"
     MELYKEYPAW LIFLRRTCAV AAGVLALPFM LFWKDRARFY SYLHRVWSKT SDKPVWMDQA        60
     EKATGDFY                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page