(data stored in ACNUC7421 zone)

EMBL: FM180568.YBFF

FM180568.YBFF        Location/Qualifiers
FT   CDS             complement(642465..643229)
FT                   /transl_table=11
FT                   /gene="ybfF"
FT                   /locus_tag="E2348C_0578"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08126"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKW8"
FT                   /protein_id="CAS08126.1"
FT                   /translation="MKLNIRAQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVNDHNI
FT                   IQVDMRNHGLSPRDPVMNYPAMAQDLVDTLDALQIDKATFIGHSMGGKAVMALTALAPD
FT                   RIDKLVAIDIAPVDYHVRRHDEIFAAINAVSESDAQTRQQAAAIMHQHLNEEGVIQFLL
FT                   KSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALFIPGGNSPYVSEQYRDDLLAQFP
FT                   QARAHVIAGAGHWVHAEKPDAVLRAIRRYLND"
     MKLNIRAQTA QNQHNNSPIV LVHGLFGSLD NLGVLARDLV NDHNIIQVDM RNHGLSPRDP        60
     VMNYPAMAQD LVDTLDALQI DKATFIGHSM GGKAVMALTA LAPDRIDKLV AIDIAPVDYH       120
     VRRHDEIFAA INAVSESDAQ TRQQAAAIMH QHLNEEGVIQ FLLKSFVDGE WRFNVPVLWD       180
     QYPHIVGWEK IPAWDHPALF IPGGNSPYVS EQYRDDLLAQ FPQARAHVIA GAGHWVHAEK       240
     PDAVLRAIRR YLND                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page