(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGA

FM180568.YBGA        Location/Qualifiers
FT   CDS             658177..658686
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="E2348C_0590"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08138"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKY0"
FT                   /protein_id="CAS08138.1"
FT                   /translation="MNQQLFDDSTLIRIFALHELHNLKDRGLTRGALLDYHSRYKLVFL
FT                   AHSQPEYRKLGPFVADIHRWQSLDDYYNQYRQRVIVLLSHPANRRDHTNVLMHVQGYFR
FT                   PHIDSTERQQLAALIDSYRRGEQPLLAPLMRIKHYMALYPDAWLSGQRYFELWPRVINL
FT                   RHAGVL"
     MNQQLFDDST LIRIFALHEL HNLKDRGLTR GALLDYHSRY KLVFLAHSQP EYRKLGPFVA        60
     DIHRWQSLDD YYNQYRQRVI VLLSHPANRR DHTNVLMHVQ GYFRPHIDST ERQQLAALID       120
     SYRRGEQPLL APLMRIKHYM ALYPDAWLSG QRYFELWPRV INLRHAGVL                   169
//

If you have problems or comments...

PBIL Back to PBIL home page