(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGE

FM180568.YBGE        Location/Qualifiers
FT   CDS             688242..688535
FT                   /transl_table=11
FT                   /gene="ybgE"
FT                   /locus_tag="E2348C_0619"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08167"
FT                   /db_xref="GOA:B7ULL5"
FT                   /db_xref="InterPro:IPR011846"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULL5"
FT                   /protein_id="CAS08167.1"
FT                   /translation="MSKIIATLYAVMDKRPLRALSFVMALLLAGCMFWDPSRFAAKTSE
FT                   LEIWHGLLLMWAVCAGVIHGVGFRPQKVLWQGIFCPLLADIVLIIGLIFFFF"
     MSKIIATLYA VMDKRPLRAL SFVMALLLAG CMFWDPSRFA AKTSELEIWH GLLLMWAVCA        60
     GVIHGVGFRP QKVLWQGIFC PLLADIVLII GLIFFFF                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page