(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGF

FM180568.YBGF        Location/Qualifiers
FT   CDS             693468..694259
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /locus_tag="E2348C_0626"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08174"
FT                   /db_xref="GOA:B7ULM2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032519"
FT                   /db_xref="InterPro:IPR034706"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULM2"
FT                   /protein_id="CAS08174.1"
FT                   /translation="MSSNFRHQLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQL
FT                   ERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVVERQKQILLQIDSLSSG
FT                   GAAAQSTSGDQNGVAASTTPTADAGTANAGAPVKSGDANTDYNAAIALVQDKSRQDDAM
FT                   VAFQNFIKNYPDSTYLPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMFK
FT                   VGVIMQDKGDTAKAKAVYQQVISKYPGTDGAKQAQKRLNAM"
     MSSNFRHQLL SLSLLVGIAA PWAAFAQAPI SSVGSGSVED RVTQLERISN AHSQLLTQLQ        60
     QQLSDNQSDI DSLRGQIQEN QYQLNQVVER QKQILLQIDS LSSGGAAAQS TSGDQNGVAA       120
     STTPTADAGT ANAGAPVKSG DANTDYNAAI ALVQDKSRQD DAMVAFQNFI KNYPDSTYLP       180
     NANYWLGQLN YNKGKKDDAA YYFASVVKNY PKSPKAADAM FKVGVIMQDK GDTAKAKAVY       240
     QQVISKYPGT DGAKQAQKRL NAM                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page