(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGI

FM180568.YBGI        Location/Qualifiers
FT   CDS             661895..662638
FT                   /transl_table=11
FT                   /gene="ybgI"
FT                   /locus_tag="E2348C_0593"
FT                   /product="conserved metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08141"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKY3"
FT                   /protein_id="CAS08141.1"
FT                   /translation="MKNTELEQLINEKLNSAAISDYAPNGLQVEGKETVQKIVTGVTAS
FT                   QALLDEAVRLGADAVIVHHGYFWKGESPVIRGMKRNRLKTLLANDINLYGWHLPLDAHP
FT                   ELGNNAQLAALLGITVMGEIEPLVPWGELTMPVPGLELASWIEARLGRKPLWCGDTGPE
FT                   VVQRVAWCTGGGQSFIDSAARFGVDAFITGEVSEQTIHSAREQGLHFYAAGHHATERGG
FT                   IRALSEWLNENTDLDVTFIDIPNPA"
     MKNTELEQLI NEKLNSAAIS DYAPNGLQVE GKETVQKIVT GVTASQALLD EAVRLGADAV        60
     IVHHGYFWKG ESPVIRGMKR NRLKTLLAND INLYGWHLPL DAHPELGNNA QLAALLGITV       120
     MGEIEPLVPW GELTMPVPGL ELASWIEARL GRKPLWCGDT GPEVVQRVAW CTGGGQSFID       180
     SAARFGVDAF ITGEVSEQTI HSAREQGLHF YAAGHHATER GGIRALSEWL NENTDLDVTF       240
     IDIPNPA                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page