(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGJ

FM180568.YBGJ        Location/Qualifiers
FT   CDS             662661..663317
FT                   /transl_table=11
FT                   /gene="ybgJ"
FT                   /locus_tag="E2348C_0594"
FT                   /product="predicted carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08142"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKY4"
FT                   /protein_id="CAS08142.1"
FT                   /translation="MQRARCYLIGETAVVLELEPPVTLASQKRIWRLAQRLVDMPNVVE
FT                   AIPGMNNITVILRNPESLALDAIERLQRWWEESEALEPESRFIEIPVVYGGAAGPDLAV
FT                   VAAHCGLSEKQVVELHSSVEYVVWFLGFQPGFPYLGSLPEQLHTPRRAEPRLHVPAGSV
FT                   GIGGPQTGVYPLATPGGWQLIGHTSLSLFDPACDEPILLRPGDSVRFVPQKEGVC"
     MQRARCYLIG ETAVVLELEP PVTLASQKRI WRLAQRLVDM PNVVEAIPGM NNITVILRNP        60
     ESLALDAIER LQRWWEESEA LEPESRFIEI PVVYGGAAGP DLAVVAAHCG LSEKQVVELH       120
     SSVEYVVWFL GFQPGFPYLG SLPEQLHTPR RAEPRLHVPA GSVGIGGPQT GVYPLATPGG       180
     WQLIGHTSLS LFDPACDEPI LLRPGDSVRF VPQKEGVC                               218
//

If you have problems or comments...

PBIL Back to PBIL home page