(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGK

FM180568.YBGK        Location/Qualifiers
FT   CDS             663311..664243
FT                   /transl_table=11
FT                   /gene="ybgK"
FT                   /locus_tag="E2348C_0595"
FT                   /product="predicted carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08143"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKY5"
FT                   /protein_id="CAS08143.1"
FT                   /translation="MLKIIRAGMYTTVQDGSRHGFRQSGISHCGALDMPALRIANLLVG
FT                   NDANAPALEITLGQLTVEFETDGWFALTGAGCEARLDDNAVWTGWRLPMRAGQRLTLKR
FT                   PQHGMRSYLAVAGGIDVPPVMGSCSTDLKVGIGGLEGRLLRDGDRLPIGKAKRDFMEAQ
FT                   GVKQLLWGNRIRALPGPEYHEFDRASQDAFWRSPWQLSSQSNRMGYRLQGQILKRTTDR
FT                   ELLSHGLLPGVVQVPHNGQPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFV
FT                   QCSLEEALKARQDQQRYFEQLAWRLHNEN"
     MLKIIRAGMY TTVQDGSRHG FRQSGISHCG ALDMPALRIA NLLVGNDANA PALEITLGQL        60
     TVEFETDGWF ALTGAGCEAR LDDNAVWTGW RLPMRAGQRL TLKRPQHGMR SYLAVAGGID       120
     VPPVMGSCST DLKVGIGGLE GRLLRDGDRL PIGKAKRDFM EAQGVKQLLW GNRIRALPGP       180
     EYHEFDRASQ DAFWRSPWQL SSQSNRMGYR LQGQILKRTT DRELLSHGLL PGVVQVPHNG       240
     QPIVLMNDAQ TTGGYPRIAC IIEADMYHLA QIPLGQPIHF VQCSLEEALK ARQDQQRYFE       300
     QLAWRLHNEN                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page