(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGL

FM180568.YBGL        Location/Qualifiers
FT   CDS             664233..664967
FT                   /transl_table=11
FT                   /gene="ybgL"
FT                   /locus_tag="E2348C_0596"
FT                   /product="predicted lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08144"
FT                   /db_xref="GOA:B7UKY6"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UKY6"
FT                   /protein_id="CAS08144.1"
FT                   /translation="MKIDLNADLGEGCASDAELLTLVSSANIACGFHAGDAQTMQACVR
FT                   EAIKNGVAIGAHPSFPDRENFGRSAMQLPPETVFAQTLYQIGALAAITRAQGGVMCHVK
FT                   PHGMLYNQAAKEAQLADAIARAVYACDPALILVGLAGSELIRAGERYGLVTREEVFADR
FT                   GYQADGSLVPRSQPGALIENEEQALAQTLEMVQYGRVKSITGEWAMVTAQTVCLHGDGE
FT                   HALAFARRLRATFAEKGIVVAA"
     MKIDLNADLG EGCASDAELL TLVSSANIAC GFHAGDAQTM QACVREAIKN GVAIGAHPSF        60
     PDRENFGRSA MQLPPETVFA QTLYQIGALA AITRAQGGVM CHVKPHGMLY NQAAKEAQLA       120
     DAIARAVYAC DPALILVGLA GSELIRAGER YGLVTREEVF ADRGYQADGS LVPRSQPGAL       180
     IENEEQALAQ TLEMVQYGRV KSITGEWAMV TAQTVCLHGD GEHALAFARR LRATFAEKGI       240
     VVAA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page