(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGS

FM180568.YBGS        Location/Qualifiers
FT   CDS             complement(698521..698901)
FT                   /transl_table=11
FT                   /gene="ybgS"
FT                   /locus_tag="E2348C_0630"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08178"
FT                   /db_xref="InterPro:IPR020363"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULM6"
FT                   /protein_id="CAS08178.1"
FT                   /translation="MKMTKLATLFLTATLSLASGAALAADSGAQSNNGQANAAADAGQV
FT                   APDARENVAPNNVDNNGVNTGSGGTMLHSDGSSMNNDGMTKDEEHKNTMCKDGRCPDIN
FT                   KKVQTGDGINNDVDTKTDGTTQ"
     MKMTKLATLF LTATLSLASG AALAADSGAQ SNNGQANAAA DAGQVAPDAR ENVAPNNVDN        60
     NGVNTGSGGT MLHSDGSSMN NDGMTKDEEH KNTMCKDGRC PDINKKVQTG DGINNDVDTK       120
     TDGTTQ                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page