(data stored in ACNUC7421 zone)

EMBL: FM180568.YBGT

FM180568.YBGT        Location/Qualifiers
FT   CDS             688129..688242
FT                   /transl_table=11
FT                   /gene="ybgT"
FT                   /locus_tag="E2348C_0618"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08166"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULL4"
FT                   /protein_id="CAS08166.1"
FT                   /translation="MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI"
     MWYFAWILGT LLACSFGVIT ALALEHVESG KAGQEDI                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page