(data stored in ACNUC7421 zone)

EMBL: FM180568.YBHH

FM180568.YBHH        Location/Qualifiers
FT   CDS             714341..715393
FT                   /transl_table=11
FT                   /gene="ybhH"
FT                   /locus_tag="E2348C_0646"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0646"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08194"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULP2"
FT                   /protein_id="CAS08194.1"
FT                   /translation="MKKIPCVMMRGGTSRGAFLLAEHLPEDQTQRDKILMAIMGSGNDL
FT                   EIDGIGGGNPLTSKVAIISRSSDPRADVDYLFAQVIVHEQRVDTTPNCGNMLSGVGAFA
FT                   IENGLIAATSPVTRVRIRNVNTGTFIEADVQTPNGVVEYEGSARIDGVPGTAAPVALTF
FT                   LNAAGTKTGKVFPTDNQIDYFDDVPVTCIDMAMPVVIIPAEYLGKTGYELPAELDADKA
FT                   LLARIESIRLQAGKAMGLGDVSNMVIPKPVLISPAQKGGAINVRYFMPHSCHRALAITG
FT                   AIAISSSCALEGTVTRQIVPSVGYGNINIEHPSGALDVHLSNEGQDATTLRASVIRTTR
FT                   KIFSGEVYLP"
     MKKIPCVMMR GGTSRGAFLL AEHLPEDQTQ RDKILMAIMG SGNDLEIDGI GGGNPLTSKV        60
     AIISRSSDPR ADVDYLFAQV IVHEQRVDTT PNCGNMLSGV GAFAIENGLI AATSPVTRVR       120
     IRNVNTGTFI EADVQTPNGV VEYEGSARID GVPGTAAPVA LTFLNAAGTK TGKVFPTDNQ       180
     IDYFDDVPVT CIDMAMPVVI IPAEYLGKTG YELPAELDAD KALLARIESI RLQAGKAMGL       240
     GDVSNMVIPK PVLISPAQKG GAINVRYFMP HSCHRALAIT GAIAISSSCA LEGTVTRQIV       300
     PSVGYGNINI EHPSGALDVH LSNEGQDATT LRASVIRTTR KIFSGEVYLP                  350
//

If you have problems or comments...

PBIL Back to PBIL home page