(data stored in ACNUC7421 zone)

EMBL: FM180568.YBHT

FM180568.YBHT        Location/Qualifiers
FT   CDS             708355..708504
FT                   /transl_table=11
FT                   /gene="ybhT"
FT                   /locus_tag="E2348C_0639"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08187"
FT                   /db_xref="GOA:B7ULN5"
FT                   /db_xref="InterPro:IPR019702"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULN5"
FT                   /protein_id="CAS08187.1"
FT                   /translation="MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQP
FT                   GQNH"
     MLELLKSLVF AVIMVPVVMA IILGLIYGLG EVFNIFSGVG KKDQPGQNH                    49
//

If you have problems or comments...

PBIL Back to PBIL home page