(data stored in ACNUC7421 zone)

EMBL: FM180568.YKGB

FM180568.YKGB        Location/Qualifiers
FT   CDS             complement(297535..298128)
FT                   /transl_table=11
FT                   /gene="ykgB"
FT                   /locus_tag="E2348C_0264"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07812"
FT                   /db_xref="GOA:B7UJF5"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJF5"
FT                   /protein_id="CAS07812.1"
FT                   /translation="MERYLHLLSRGDKIGLTLIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQTANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSARDILKQRSNESSSTLKTEY"
     MERYLHLLSR GDKIGLTLIR LSIAIVFMWI GLLKFVPYEA DSITPFVANS PLMSFFYEHP        60
     EDYKQYLTHE GEYKPEARAW QTANNTYGFS NGLGVVEVII ALLVLANPVN RWLGLLGGLM       120
     AFTTPLVTLS FLITTPEAWV PALGDAHHGF PYLSGAGRLV LKDTLMLAGA VMIMADSARD       180
     ILKQRSNESS STLKTEY                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page