(data stored in ACNUC7421 zone)

EMBL: FM180568.YKGC

FM180568.YKGC        Location/Qualifiers
FT   CDS             complement(298485..299810)
FT                   /transl_table=11
FT                   /gene="ykgC"
FT                   /locus_tag="E2348C_0266"
FT                   /product="predicted oxidoreductase with FAD/NAD(P)-binding
FT                   domain and dimerization domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07814"
FT                   /db_xref="GOA:B7UJF7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJF7"
FT                   /protein_id="CAS07814.1"
FT                   /translation="MNKYQAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAMYGGTCIN
FT                   IGCIPTKTLVHDAQQHTDFVRAIQRKNEVVNFLRNKNFHNLADMPNIDVIDGLAEFINN
FT                   HSLRVHRPGRNLEIHGEKIFINTGAQAVVPPIPGITTTPGVYDSTGLLNLKELPGHLGI
FT                   LGGGYIGVEFASMFANFGSKVTILEAASLFLPREDRDIADNIATILRDQGVDIILNAHV
FT                   ERISHHENQVQVHSEHAQLAVDALLIASGRQPATASLHPENAGIAVNERGAIVVDKQLH
FT                   TTANNIWAMGDVTGGLQFTYISLDDYRIVRDELLGEGRRSTDDRKNVPYSVFMTPPLSR
FT                   VGMTEEQARESGADIQVVTLPVAAIPRARVMNDTRGVLKAIVDNKTQRILGASLLCVDS
FT                   HEMINIVKMVMDAGLPYSILRDQIFTHPSMSESLNDLFSLVK"
     MNKYQAVIIG FGKAGKTLAV TLAKAGWRVA LIEQSNAMYG GTCINIGCIP TKTLVHDAQQ        60
     HTDFVRAIQR KNEVVNFLRN KNFHNLADMP NIDVIDGLAE FINNHSLRVH RPGRNLEIHG       120
     EKIFINTGAQ AVVPPIPGIT TTPGVYDSTG LLNLKELPGH LGILGGGYIG VEFASMFANF       180
     GSKVTILEAA SLFLPREDRD IADNIATILR DQGVDIILNA HVERISHHEN QVQVHSEHAQ       240
     LAVDALLIAS GRQPATASLH PENAGIAVNE RGAIVVDKQL HTTANNIWAM GDVTGGLQFT       300
     YISLDDYRIV RDELLGEGRR STDDRKNVPY SVFMTPPLSR VGMTEEQARE SGADIQVVTL       360
     PVAAIPRARV MNDTRGVLKA IVDNKTQRIL GASLLCVDSH EMINIVKMVM DAGLPYSILR       420
     DQIFTHPSMS ESLNDLFSLV K                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page