(data stored in ACNUC7421 zone)

EMBL: FM180568.YKGF

FM180568.YKGF        Location/Qualifiers
FT   CDS             302149..303576
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="E2348C_0269"
FT                   /product="predicted amino acid dehydrogenase with
FT                   NAD(P)-binding domain and ferridoxin-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07817"
FT                   /db_xref="GOA:B7UJG0"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJG0"
FT                   /protein_id="CAS07817.1"
FT                   /translation="MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDEL
FT                   GHWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFAKTKEDATRYILQVAQRK
FT                   NARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRH
FT                   QIRRVLHERLGYEGPETPEAMTLFIRQKIREDFLSVEIGITGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPKTHIAVMGMERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAG
FT                   HVDGPEEFHLVIVDNGRSEVLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYKDFKDLPYACSLCTACDSVCPVRIPLSKLILRHRRVMAEKGITAKAE
FT                   QRAIKMFAYANSHPGLWKVGMMAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGE
FT                   SFRSWFKKHQAQEKKNG"
     MSIKTSNTDF KTRIRQQIED PIMRKAVANA QQRIGANRQK MVDELGHWEE WRDRAAQIRD        60
     HVLSNLDAYL YQLSEKVTQN GGHVYFAKTK EDATRYILQV AQRKNARKVV KSKSMVTEEI       120
     GVNHVLQDAG IQVIETDLGE YILQLDQDPP SHVVVPAIHK DRHQIRRVLH ERLGYEGPET       180
     PEAMTLFIRQ KIREDFLSVE IGITGCNFAV AETGSVCLVT NEGNARMCTT LPKTHIAVMG       240
     MERIAPTFAE VDVLITMLAR SAVGARLTGY NTWLTGPREA GHVDGPEEFH LVIVDNGRSE       300
     VLASEFRDVL RCIRCGACMN TCPAYRHIGG HGYGSIYPGP IGAVISPLLG GYKDFKDLPY       360
     ACSLCTACDS VCPVRIPLSK LILRHRRVMA EKGITAKAEQ RAIKMFAYAN SHPGLWKVGM       420
     MAGAHAASWF INGGKTPLKF GAISDWMEAR DLPEADGESF RSWFKKHQAQ EKKNG            475
//

If you have problems or comments...

PBIL Back to PBIL home page