(data stored in ACNUC7421 zone)

EMBL: FM180568.YKGI

FM180568.YKGI        Location/Qualifiers
FT   CDS             complement(298140..298376)
FT                   /transl_table=11
FT                   /gene="ykgI"
FT                   /locus_tag="E2348C_0265"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07813"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJF6"
FT                   /protein_id="CAS07813.1"
FT                   /translation="MFKKSVLFATLLSGVMAFSTNADDKIILKHISVSSVSASPTVLEN
FT                   AIADMARKYNASSWKVTSMRIDNNSTATAVLYK"
     MFKKSVLFAT LLSGVMAFST NADDKIILKH ISVSSVSASP TVLENAIADM ARKYNASSWK        60
     VTSMRIDNNS TATAVLYK                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page