(data stored in ACNUC7421 zone)

EMBL: FM180568.YKIA

FM180568.YKIA        Location/Qualifiers
FT   CDS             367825..368103
FT                   /transl_table=11
FT                   /gene="ykiA"
FT                   /locus_tag="E2348C_0328"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07876"
FT                   /db_xref="InterPro:IPR024497"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJL6"
FT                   /protein_id="CAS07876.1"
FT                   /translation="MLQSRNDHLRQTALRNAHTPVLLTTLTESQDRSLAINNPQLAADV
FT                   KTVWLKEEPSLLLFVDQPALSQLRDLVKTGATRKIRSEARHRLEEKQ"
     MLQSRNDHLR QTALRNAHTP VLLTTLTESQ DRSLAINNPQ LAADVKTVWL KEEPSLLLFV        60
     DQPALSQLRD LVKTGATRKI RSEARHRLEE KQ                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page