(data stored in ACNUC7421 zone)

EMBL: FM180568.YLBA

FM180568.YLBA        Location/Qualifiers
FT   CDS             complement(501125..501910)
FT                   /transl_table=11
FT                   /gene="ylbA"
FT                   /locus_tag="E2348C_0448"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07996"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKJ2"
FT                   /protein_id="CAS07996.1"
FT                   /translation="MGYLNNVTGYRDDLLANRAIVKHGNFALLTPDGLVKNIIPGFENC
FT                   DATILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFTLS
FT                   EGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRYIPVEGHAPWLVSGNASELERIHYEGMD
FT                   DVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVEI"
     MGYLNNVTGY RDDLLANRAI VKHGNFALLT PDGLVKNIIP GFENCDATIL STPKLGASFV        60
     DYLVTLHQNG GNQQGFGGEG IETFLYVISG NITAKAEGKT FTLSEGGYLY CPPGSLMTFV       120
     NAQAEDSQIF LYKRRYIPVE GHAPWLVSGN ASELERIHYE GMDDVILLDF LPKELGFDMN       180
     MHILSFAPGA SHGYIETHVQ EHGAYILSGQ GVYNLDNNWI PVKKGDYIFM GAYSLQAGYG       240
     VGRGEAFSYI YSKDCNRDVE I                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page