(data stored in ACNUC7421 zone)

EMBL: FM180568.YLBF

FM180568.YLBF        Location/Qualifiers
FT   CDS             507491..508306
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="E2348C_0453"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08001"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKJ7"
FT                   /protein_id="CAS08001.1"
FT                   /translation="MTIIHPLLASRSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQ
FT                   GSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPAH
FT                   PQALAVAWMQRAEETGLFGPLALAASDPLPAELRQFRHCFQAALNGVKTDWRHWLGKGP
FT                   GLTPSHDDTLSGMLLAAWYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFA
FT                   SPLLHFVHALSCPKRTAAAIDSLLALGHTSGADTLLGFWLGQQLLQGKP"
     MTIIHPLLAS RSAPNYRQSW RLAGVWRRAI NLMTESGELL TLHRQGSGFG PGGWVLRRAQ        60
     FDALCGGLCG NERPQVVAQG IRLGRFTVKQ PQRYCLLRIT PPAHPQALAV AWMQRAEETG       120
     LFGPLALAAS DPLPAELRQF RHCFQAALNG VKTDWRHWLG KGPGLTPSHD DTLSGMLLAA       180
     WYYGALDARS GRPFFACSDN LQLVTTAVSV SYLRYAAQGY FASPLLHFVH ALSCPKRTAA       240
     AIDSLLALGH TSGADTLLGF WLGQQLLQGK P                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page