(data stored in ACNUC7421 zone)

EMBL: FM180568.ZITB

FM180568.ZITB        Location/Qualifiers
FT   CDS             complement(697466..698407)
FT                   /transl_table=11
FT                   /gene="zitB"
FT                   /locus_tag="E2348C_0629"
FT                   /product="zinc efflux system protein ZitB"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08177"
FT                   /db_xref="GOA:B7ULM5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR023500"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULM5"
FT                   /protein_id="CAS08177.1"
FT                   /translation="MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVIGGFLSGSL
FT                   ALLADAGHMLTDTAALLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITIL
FT                   IVWEAIERFRTPRPVEGGMMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGD
FT                   LLGSVGAIIAALIIIWTGWTPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDI
FT                   AELKRRMCREIPEVRNVHHVHVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQ
FT                   IEHATIQMEYQPCHGPDCHLNRGVSGHSHHHH"
     MAHSHSHTSS HLPEDNNARR LLYAFGVTAG FMLVEVIGGF LSGSLALLAD AGHMLTDTAA        60
     LLFALLAVQF SRRPPTIRHT FGWLRLTTLA AFVNAIALVV ITILIVWEAI ERFRTPRPVE       120
     GGMMMAIAVA GLLANILSFW LLHHGSEEKN LNVRAAALHV LGDLLGSVGA IIAALIIIWT       180
     GWTPADPILS ILVSLLVLRS AWRLLKDSVN ELLEGAPVSL DIAELKRRMC REIPEVRNVH       240
     HVHVWMVGEK PVMTLHVQVI PPHDHDALLD QIQHYLMDHY QIEHATIQME YQPCHGPDCH       300
     LNRGVSGHSH HHH                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page