(data stored in SCRATCH zone)

EMBL: FM954973.PE117

FM954973.PE117       Location/Qualifiers
FT   CDS             complement(132096..132437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0120"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25388"
FT                   /db_xref="GOA:B7VQ90"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25388.1"
FT                   /translation="MNEICPTTGGCALPIGHGDTEAETQMAALAKALAHPARVRILSIL
FT                   STLEKSGGCLNSDLVSELGLAQSTVSEHLRILKTSGFITAESIPPKMCYRINRDNIQQF
FT                   ETLIDTILK"
     MNEICPTTGG CALPIGHGDT EAETQMAALA KALAHPARVR ILSILSTLEK SGGCLNSDLV        60
     SELGLAQSTV SEHLRILKTS GFITAESIPP KMCYRINRDN IQQFETLIDT ILK              113
//

If you have problems or comments...

PBIL Back to PBIL home page