(data stored in SCRATCH zone)

EMBL: FM954973.PE124

FM954973.PE124       Location/Qualifiers
FT   CDS             138201..138539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0127"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25400"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25400.1"
FT                   /translation="MRKSDKKIENQIRDVLTDVCEDTLKGFDGFLWVTHTVNFSSFPQS
FT                   LKIVCVFDTNQDRTNFLEVGGQQEVSVAIQKAFSQVGITLKSIDKHVSYDTQENCDRDH
FT                   QGKWNKRL"
     MRKSDKKIEN QIRDVLTDVC EDTLKGFDGF LWVTHTVNFS SFPQSLKIVC VFDTNQDRTN        60
     FLEVGGQQEV SVAIQKAFSQ VGITLKSIDK HVSYDTQENC DRDHQGKWNK RL               112
//

If you have problems or comments...

PBIL Back to PBIL home page