(data stored in SCRATCH zone)

EMBL: FM954973.PE15

FM954973.PE15        Location/Qualifiers
FT   CDS             complement(22321..22524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25201"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25201.1"
FT                   /translation="MISAGRGPVSPSGDKSRFGKGKGFGMTAKYLGRHDKNNTLKSAED
FT                   EFVNDHERCFLFFKERSLLITT"
     MISAGRGPVS PSGDKSRFGK GKGFGMTAKY LGRHDKNNTL KSAEDEFVND HERCFLFFKE        60
     RSLLITT                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page