(data stored in SCRATCH zone)

EMBL: FM954973.PE198

FM954973.PE198       Location/Qualifiers
FT   CDS             231825..232766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0202"
FT                   /product="Lipase precursor"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; PubMedId :
FT                   2162464; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25536"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25536.1"
FT                   /translation="MKKILIWTIACLSSFGVYAGTSASALETSGYTATKYPIMLVHGLF
FT                   GFDTLAGVDYFYGVPESLTKDGASVYVAQVSATNSSEVRGEQLLAQVETLLAATGASKV
FT                   NLVGHSHGGPTARYVASVRPDLVASVTSIGGVHKGSKVADLVRGTVSEGSVSEGIAVKL
FT                   AGGLTALINLLSGGTDLDQDGLASLEALTTEGSLAFNQFYPEGVPTSECGDGEWQANNG
FT                   VYYYSWTGSSTFTNLLDPTDGAMTILGLAFNEPNDGLVGACSAHLGKVIGDDYKMNHLD
FT                   EINGLLGIHHLFETDPVTLYRQHANRLKLAGL"
     MKKILIWTIA CLSSFGVYAG TSASALETSG YTATKYPIML VHGLFGFDTL AGVDYFYGVP        60
     ESLTKDGASV YVAQVSATNS SEVRGEQLLA QVETLLAATG ASKVNLVGHS HGGPTARYVA       120
     SVRPDLVASV TSIGGVHKGS KVADLVRGTV SEGSVSEGIA VKLAGGLTAL INLLSGGTDL       180
     DQDGLASLEA LTTEGSLAFN QFYPEGVPTS ECGDGEWQAN NGVYYYSWTG SSTFTNLLDP       240
     TDGAMTILGL AFNEPNDGLV GACSAHLGKV IGDDYKMNHL DEINGLLGIH HLFETDPVTL       300
     YRQHANRLKL AGL                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page